PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100142870031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 274aa    MW: 30733.1 Da    PI: 6.958
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100142870031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like61.71.4e-194178138
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkv 38
                                  kprl+Wt +LHerF+eav+qLGG+ekAtPk++l+lm++
  Ote100142870031|100142870031 41 KPRLKWTLDLHERFIEAVKQLGGAEKATPKSVLKLMGI 78
                                  79**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-153978IPR009057Homeodomain-like
SuperFamilySSF466894.66E-64078IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-134180IPR006447Myb domain, plants
PfamPF143796.6E-22115160IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MYHCHHHQGK NVHPVPQEKH MLLQGVTGTG DSGLVLSSDA KPRLKWTLDL HERFIEAVKQ  60
LGGAEKATPK SVLKLMGIXX XXNIVSLEES PSAKADRVLE VNGPHLPNQP TKSLQLDEAI  120
QMQIEVQQRL HEQMEVQRHL QMRIEAQGKY LQDVLEKAQE SLGRQNVGTL GLETAKVQLS  180
ELVSQVSKQS LDSGIKQVSD CCHQQLYEKH LGVKPMTATE QVIDDKQSLS MSIGLEPNAK  240
WNNTIKQDEQ RSCSDLKLPF FPTKLDLQAT SSWI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094327.15e-87PREDICTED: uncharacterized protein LOC105174060
TrEMBLA0A061F9P85e-81A0A061F9P8_THECC; Homeodomain-like superfamily protein isoform 2
TrEMBLA0A151RMZ23e-81A0A151RMZ2_CAJCA; Myb family transcription factor APL
STRINGVIT_08s0007g07580.t012e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451